PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03533.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 335aa    MW: 38090.5 Da    PI: 8.4025
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03533.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.2e-52171432128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                               pGfrFhPtdeelv++yLk+kv +k+l++ e ik+vdiyk++PwdLpk ++ +ekewyf+++rd+ky++++r+nr+t  g+Wkatg
  Rsa1.0_03533.1_g00002.1  17 LPGFRFHPTDEELVSFYLKRKVLHKSLPF-ELIKKVDIYKYDPWDLPKLAAMGEKEWYFYCPRDRKYRNSTRPNRVTGGGFWKATG 101
                              69**************************9.89***************8778899******************************** PP

                      NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +d++++s  +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  Rsa1.0_03533.1_g00002.1 102 TDRPIYSLdSTRCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 143
                              ******9856677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-5815186IPR003441NAC domain
PROSITE profilePS5100556.00216186IPR003441NAC domain
PfamPF023652.3E-2518143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDDEESNTVE RFDDVVLPGF RFHPTDEELV SFYLKRKVLH KSLPFELIKK VDIYKYDPWD  60
LPKLAAMGEK EWYFYCPRDR KYRNSTRPNR VTGGGFWKAT GTDRPIYSLD STRCIGLKKS  120
LVFYRGRAAK GIKTDWMMHE FRLPSLSDSH HSSSYTSYNN KKQHHNINNK EIPSSDAWAI  180
CRIFKKTNAV SSQRSVPQSW LYPAIPDTSQ YNSPSQTTTL FASTDVFSNM ATRQNLISSP  240
VDEPASFTES AAAYLASQML GVPYNIARNN GTGDTIFLRN NETGNALFPS NNDHNYFHNL  300
AGGLTNELPN VRSMVETGFE TTTSEMSATS YSPNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-531818817170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0168761e-113AB016876.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKM21.
GenBankCP0026881e-113CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankHG9686031e-113HG968603.1 Arabidopsis thaliana T-DNA flanking sequence, clone GK-027D08-028756.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013589257.10.0PREDICTED: putative NAC domain-containing protein 94
SwissprotQ9FIW50.0NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A078FF980.0A0A078FF98_BRANA; BnaC06g12700D protein
TrEMBLA0A0D3CT030.0A0A0D3CT03_BRAOL; Uncharacterized protein
STRINGBra028441.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.10.0NAC domain containing protein 94